85-4675-86　COL17A1, Recombinant, Human, aa1253-1497, His-Tag (Collagen alpha-1(XVII) Chain) 20ug　372822

特徴

• May play a role in the integrity of hidesmosome and the attachment of basal keratinocytes to the underlying basent membrane. The 120kD linear IgA disease antigen is an anchoring filament component involved in dermal-epidermal cohesion. Is the target of linear IgA bullous dermatosis autoantibodies.
• Source:Partial recombinant protein corresponding to aa1253-1497 from human COL17A1, fused to His-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~28.5kD
• Amino Acid Sequence:YLTSPDVRSFIVGPPGPPGPQGPPGDSRLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGISKVFSAYSNVTADLMDFFQTYGAIQGPPGQKGEMGTPGPKGDRGPAGPPGHPGPPGPRGHKGEKGDKGDQVYAGRRRRRSIAVKP
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.