85-4665-35　ApoA5, Recombinant, Rat, aa27-367, GST-Tag (Apolipoprotein A-V) 100ug　372294

特徴

• Minor apolipoprotein mainly associated with HDL and to a lesser extent with VLDL. May also be associated with chylomicrons. Important determinant of plasma triglyceride (TG) levels by both being a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and a inhibitor of the hepatic VLDL-TG production rate (without affecting the VLDL-apoB production rate). Activates poorly lecithin:cholesterol acyltransferase (LCAT) and does not enhance efflux of cholesterol from macrophages.
• Source:Recombinant protein corresponding to aa27-367 from rat Apoa5, fused to GST-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~40kD
• AA Sequence:RKSFWEYFGQNSQGKGMMGQQQKLAQESLKGSLEQDLYNMNNFLEKLGPLREPGKEPPRLAQDPEGIRKQLQQELEEVSTRLEPYMAAKHQQVGWNLEGLRQQLKPYTVELMEQVGLSVQDLQEQLRMVGKGTKAQLLGGVDEAMSLLQDMQSRVLHHTDRVKELFHPYAERLVTGIGHHVQELHRSVAPHAVASPARLSRCVQTLSHKLTRKAKDLHTSIQRNLDQLRDELSTFIRVSTDGADNRDSLDPQALSDEVRQRLQAFRHDTYLQIAAFTQAIDQETEEIQHQLAPPPPSHSAFAPELGHSDSNKALSRLQSRLDDLWEDIAYGLHDQGHSQNNPEGHSG
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.