85-4662-01　ACRV1, Recombinant, Human, aa22-265, His-SUMO-Tag (Acrosomal Protein SP-10) 20ug　372130

特徴

• ACRV1 (Acrosomal vesicle protein 1), also known as acrosomal protein SP-10 or SPACA2, is a 265aa protein. ACRV1 is encoded by a gene that maps to human chromosome 11q24.2, at the junction between 11q23 and 11q24. Containing four exons, ACRV1 may experience cryptic splicing and exon skipping. ACRV1 exists as 11 alternatively spliced isoforms and may be involved in sperm-zona binding or penetration. ACRV1 encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1 that originates in the acrosomal vesicle during spermatogenesis, and is affiliated with acrosomal membranes and mature sperm matrix. ACRV1 is a potential contraceptive vaccine immunogen.
• Recombinant protein corresponding to aa22-265 from human ACRV1, fused to His-SUMO-tag at N-terminal, expressed in E. coli.
• Molecular Weight:~41.8kD
• Amino Acid Sequence:QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.