85-4659-57　Profilin, Recombinant, Toxoplasma Gondii, aa2-163, His-Tag (PRF) 20ug　370758

特徴

• TLR11, an innate sensor for profilin (Toxoplasma gondii), is an intracellular receptor that resides in the endoplasmic reticulum. The 12 membrane-spanning endoplasmic reticulum-resident protein UNC93B1 interacts directly with TLR11 and regulates the activation of dendritic cells in response to profilin (Toxoplasma gondii) and parasitic infection in vivo. TLR12, a previously uncharacterized TLR, also recognizes profilin from Toxoplasma gondii. TLR12 is sufficient for recognition of profilin by plasmacytoid dendritic cells (pDCs), whereas TLR11 and TLR12 are both required in macrophages and conventional DCs. In contrast to TLR11, TLR12-deficient mice succumb rapidly to T. gondii infection.
• Recombinant protein corresponding to aa2-163 from Toxoplasma gondii Profilin, fused to His-Tag at N-terminal, expressed in yeast.
• Molecular Weight:~19.4kD
• AA Sequence:SDWDPVVKEWLVDTGYCCAGGIANAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.