85-4658-84　OmcA, Recombinant, Chlamydia Trachomatis, aa19-88, His-SUMO-Tag (Small Cysteine-rich Outer Membrane protein OmcA) 20ug　370722

特徴

• In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity).
• Source:Recombinant protein corresponding to aa19-88 from Chlamydia trachomatis OmcA, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~23.4kD
• AA Sequence:CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.