85-4655-57　CEACAM8, Recombinant, Human, aa35-320, His-SUMO-Tag (Carcinoembryonic Antigen-related Cell Adhesion Molecule 8, CD66b, Cluster of Differentiation 66b) 20ug　370559

特徴

• Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) also known as CD66b (Cluster of Differentiation 66b), is a human gene. In neutrophils, the CEACAM8 gene is primarily detected in the secondary granules within the cytoplasm, but it can also be found in lower amounts on the plasma membrane. The amount of CD67 on the plasma membrane is up-regulated upon granulocyte activation. CD67 has been located on the surface of neutrophilic and eosinophilic granulocytes at late stages of differentiation.
• Source:Recombinant protein corresponding to aa35-320 from human CEACAM8, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~47.5kD
• Amino Acid Sequence:QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.