85-4655-55　CEACAM7, Recombinant, Human, aa36-242, His-SUMO-Tag (Carcinoembryonic Antigen-related Cell Adhesion Molecule 7, CGM2) 20ug　370558

特徴

• CEA-related cell adhesion molecule 7 (CEACAM7, CGM2) belongs to the carcinoembryonic antigen (CEA) family. It encodes a glycosyl phosphatidyl inositol (GPI)-linked glycoprotein which is only found on the apical surface of highly differentiated epithelial cells adult colon and on a small epithelial cell population in pancreatic ducts. CEACAM7 expression is completely lost upon malignant transformation already in hyperplastic polyps and early adenomas as well as in adenocarcinomas of the colon. Like all members of the CEACAM family, it consists of a single N domain, with structural homology to the immunoglobulin variable domains, followed by one immunoglobulin constant-like A domain.
• Source:Recombinant protein corresponding to aa36-242 from human CEACAM7, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~39.4kD
• Amino Acid Sequence:TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.