85-4655-53　CEACAM3, Recombinant, Human, aa35-155, His-SUMO-Tag (Carcinoembryonic Antigen-related Cell Adhesion Molecule 3, CD66D, CGM1) 20ug　370557

特徴

• This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
• Source:Partial recombinant protein corresponding to aa35-155 from human CEACAM3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.
• Molecular Weight:~29.1kD
• Amino Acid Sequence:KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.