85-4640-50　17kD Surface Antigen (omp), Strain ATCC VR-1363/YH, Rickettsia japonica, Recombinant, aa20-159, His-SUMO-Tag 20ug　367193

特徴

• Recombinant protein corresponding to full length Rickettsia japonica 17kD Surface Antigen (omp) (strain ATCC VR-1363/YH) (aa20-159, UniProt accession #Q52764), fused to His-SUMO-Tag at N-terminal, expressed in E. coli.
• Rickettsia rickettsii is an obligate intracellular Gram-negative bacterium that causes Rocky Mountain spotted fever (RMSF), a serious life-threatening disease. RMSF was first found in the Snake River Valley of Idaho in 1896 and described by Edward E Maxey [1]. Patients suffering from RMSF usually present fever, headache, myalgias, and rash, as well as a history of tick bite or contact. For serious R. rickettsii infection, patients will develop symptoms of acute lung edema, renal failure, and/or encephalitis [2], [3] due to wide spread vasculitis caused by rickettsial infection of endothelial cells lining the small blood vessels in these vital organs [4], [5].
• Appearance:Supplied as a liquid in Tris, 50% glycerol.
• Purity:~90% (SDS-PAGE)
• Molecular Weight:~31.4kD
• AA Sequence:CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN
• Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.