85-4624-95　［取扱停止］Osteoprotegerin/Fc Chimera, Recombinant, Human (OPG-Fc) 10ug　360925

特徴

• Source:Recombinant protein corresponding to 412aa residues, including 180 residues from mature OPG (aa22-201) and 232 residues from the Fc protein of human IgG1 from human Osteoprotegerin/Fc Chimera expressed in Pichia Pastoris.
• Molecular Weight:~46.5kD (412aa)
• Applications:Suitable for use in SDS-PAGE. Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Biological Activity:Fully biologically active when compared to the standard. Determined by its ability to neutralize the stimulation of U937 cells treated with 10ng/ml of soluble RANKL.
• Endotoxin:<1EU/mg (LAL)
• AA Sequence:ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGN SESTQKCGIDVTL Fc232: EPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Storage and Stability:Lyophilized powder may be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.