85-4624-91　［取扱停止］Oncostatin-M, Recombinant, Human (OSM) 2ug　360915

特徴

• Source:Recombinant protein corresponding to human Oncostatin-M, a single non-glycosylated polypeptide chain containing 227aa, expressed in E. coli.
• Molecular Weight:~26kD (227aa)
• Applications:Suitable for use in SDS-PAGE. Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Biological ActivityFully biologically active when compared to the standard. The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is <2ng/ml, corresponding to a specific activity of >5×10e5units/mg.
• Endotoxin:<1EU/mg (LAL)
• AA Sequence:AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
• Storage and Stability:Lyophilized powder may be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.