85-4624-59　［取扱停止］Migration Inhibitor Factor, Recombinant, Human (MIF) 10ug　360782

特徴

• Migration Inhibitory Factor (MIF) is a pro-inflammatory cytokine that acts on fibroblasts by inducing IL-1, IL-8 and MMP expression. MIF stimulates NO production and TNF-a release following IFNy-activation of macrophages.
• Source:Recombinant protein corresponding to human Migration Inhibitor Factor, a single non-glycosylated polypeptide chain containing 123aa, expressed in E. coli.
• Molecular Weight:~13.5kD (123aa)
• Applications:Suitable for use in SDS-PAGE. Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Biological Activity:Fully biologically active measured by its ability to bind rhCD74 in a functional ELISA.
• Endotoxin:<1EU/mg (LAL)
• AA Sequence:MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH
• Storage and Stability:Lyophilized powder may be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.