85-4624-13　［取扱停止］Keratinocye Growth Factor-1, Recombinant, Human (KGF-1) 2ug　360644

特徴

• Source:Recombinant protein corresponding to human Keratinocye Growth Factor-1, a single, non-glycosylated polypeptide chain containing 164aa, expressed in E. coli.
• Molecular Weight:~19kD (164aa)
• Applications:Suitable for use in SDS-PAGE. Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Biological ActivityThe biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing KGF receptors yielding an ED50 <10ng/ml, corresponding to a specific activity of ≥1x10e5units/mg.
• Endotoxin:<1EU/mg (LAL)
• AA Sequence:MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQK GIPVRGKKTK KEQKTAHFLP MAIT
• Storage and Stability:Lyophilized powder may be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.