85-4624-08　［取扱停止］IP-10, Recombinant, Human (Interferon gamma Inducible Protein, CXCL10) 25ug　360614

特徴

• Chemokine (C-X-C motif) ligand 10 (CXCL10) is a small cytokine belonging to the CXC chemokine family that is also known as 10kD interferon-gamma-induced protein (gamma-IP10 or IP-10). CXCL10 is secreted by several cell types in response to IFN-gamma. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemo attraction for monocytes and T cells, promotion of T cell adhesion to endothelial cells, anti tumor activity, and inhibition of bone marrow colony formation and angiogenesis. The gene for CXCL10 is located on human chromosome 4 in a cluster among several other CXC chemokines. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. The three-dimensional crystal structure of this chemokine has been determined under 3 different conditions to a resolution of up to 1.92A.
• Source:Recombinant protein corresponding to human IP-10, a single non-glycosylated polypeptide chain containing 77aa expressed in E. coli.
• Molecular Weight:~8.5kD (77aa)
• Applications:Suitable for use in SDS-PAGE. Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Biological Activity:Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 10-100ng/ml, corresponding to a specific activity of ＞1x10e4IU/mg.
• Endotoxin:<1EU/mg (LAL)
• AA Sequence:VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKEMSKRSP
• Storage and Stability:Lyophilized powder may be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.