85-4622-06　［取扱停止］Glia Maturation Factor beta, Recombinant, Human (GMFB, GMF-beta) 10ug　360312

特徴

• GMFB, also known as GMF, belongs to the GMF subfamily of the larger actin-binding protein ADF family. This protein, which is phosphorylated following phorbol ester stimulation, is important for the nervous system. It causes brain cell differentiation, stimulates neural regeneration and inhibits tumor cell proliferation. Overexpression of GMFB in astrocytes has been shown to enhance brain-derived neurotrohic factor (BDNF) production. GMFB expression is increased by exercise, and the protein is crucial for exercise-induction of BDNF.
• Source:Recombinant protein corresponding to human Glia Maturation Factor beta, a single non-glycosylated polypeptide chain containing 141aa, expressed in E. coli.
• Molecular Weight:~16.5kD (141aa)
• Applications:Suitable for use in SDS-PAGE. Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Endotoxin:<1EU/mg (LAL)
• AA Sequence:SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNT EDLTEEWLREKLGFFH
• Storage and Stability:Lyophilized powder may be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.