85-4621-71　［取扱停止］ErbB3 Fragment, Recombinant, Human, His-Tag (ErbB3-f) 20ug　360196

特徴

• Source:Recombinant protein corresponding to human ErbB3 Fragment, a single non-glycosylated fusion polypeptide chain, containing 171aa (Ser20- Cys190) with N-terminus Thioredoxin Tag and His-Tag, expressed in E. coli.
• Molecular Weight:~34kD (170aa)
• Applications:Suitable for use in SDS-PAGE. Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Biological Activity:Measured by its ability to postpone tumor emerge time of spontaneous breast cancer in FVB/N transgenic mice and inhibit the development of tumor, effectively inhibit the growth of in situ transplanted breast cancer in FVB/N transgenic mice.
• Endotoxin:<1EU/ug (LAL)
• AA Sequence:MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHP DLGTDDDDKAMADIGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYN TNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVC
• Storage and Stability:May be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.