85-4620-89　［取扱停止］Angiostatin K 1-3, Recombinant, Human 10ug　359785

特徴

• Ang K1-3 is a single, non-glycosylated polypeptide chain containing 259aa. It represents a proteolytic fragment of plasminogen containing the first three kringle structures. A specific inhibitor of endothelial cell growth and angiogenesis. Displays increased inhibitory activity (ED50=70nM) relative to kringles 1-4 (ED50=135nM). Ang K1-3 reduces endothelial cell proliferation and acts as a potent inhibitor of angiogenesis and tumor growth.
• Source:Recombinant protein corresponding to human Angiostatin K1-3 expressed in E. coli.
• Molecular Weight:~30kD (259aa)
• Applications:Suitable for use in SDS-PAGE. Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Biological Activity:The activity is assayed on anti-proliferation and anti-migration of endothelial cells in vitro and anti-angiogenesis in vivo. The specific activity of anti-migration of endothelial cells in vitro is 0.55×10e5Units/mg.
• Endotoxin:<1EU/ug (LAL)
• AA Sequence:VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP
• Storage and Stability:Lyophilized powder may be stored at -20°C. Reconstitute with sterile dH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.