85-4425-13　［取扱停止］Transforming Growth Factor Beta 2, Recombinant, Human, His-Tag (TGFB2, TGF Beta2) 5ug　299547

特徴

• TGFB2 is a 27.08kD protein having two identical 118aa peptide chains linked by a single disulfide bond. TGFB2 is part of a family of five related cytokines that have an extensive variation of normal and neoplastic cells, indicating the importance of these homodimer proteins as multi-functional regulators of cellular activity. The three mammalian isoforms of TGF-beta (TGFb1, TGFb2 and TGFb3) signal through the same receptor and stimulate similar biological responses. They are involved in physiological processes as embryogenesis, tissue remodelling and wound healing.
• Source:Recombinant protein corresponding to human TGFB2, a homodimeric polypeptide chain containing 2x118aa, fused to 6xHis-tag at N-terminal, expressed in Nicotiana benthamiana.
• Molecular Weight:~27.08kD
• Biological Activity:Measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. The ED50 is <40ng/ml, corresponding to a specific activity of 25,000units/mg.
• AA Sequence: HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH EPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASAS PCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS
• Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.