This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. [provided by RefSeq, Jul 2008]
Source:Recombinant protein corresponding to single bromodomain, aa1335-1450, from human BAZ1B, fused to His-tag at N-terminal, expressed in E. coli.
Molecular Weight:~14.7kD
AA Sequence:MHHHHHHKRSSRRQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPMDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYV
Applications:Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ug
Source Antigen：Recombinant, E. coli
Grade：Highly Purified
Purity：Highly Purified (~90%)
Form：Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM sodium chloride, 2.2mM potassium chloride, 20% glycerol.
