Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
Source:Synthetic human Thymosin B4, at C-terminal
AA Sequence:SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES-L-Biotin. Underlined amino acids were added or modified for technical reasons.
Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size:100ug
Source Antigen:Synthetic
Grade:Highly Purified
Purity:~95% (HPLC)
Form:Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid. Labeled with Biotin.