AA Sequence:MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKETIEQEKEFVKRS
Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile 0.1% acetic acid. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size：100ug
Source Antigen：Synthetic
Grade：Highly Purified
Purity：≥95% (HPLC)
Form：Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.
