The protein encoded by this gene is a hormone secreted by parathyroid cells. This hormone elevates blood Ca2+ level by dissolving the salts in bone and preventing their renal excretion. Defects in this gene are a cause of familial isolated hypoparathyroidism (FIH). [provided by RefSeq, Jul 2008]
Source:Synthetic human Parathyroid Hormone
AA Sequence:SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size:100ug
Source Antigen:Synthetic
Grade:Highly Purified
Purity:~95% (HPLC)
Form:Supplied as a lyophilized powder. Reconstitute with 0.1% acetic acid.