Oxyntomodulin (porcine, bovine) is a GLP-1 receptor agonist. Endogenous preproglucagon-derived neuropeptide that modulates feeding and metabolism. Also secreted by intestinal L-cells. Increases cAMP production and inhibits gastric acid secretion in rat stomach. Also weak glucagon receptor agonist.
Synonyms:Glucagon (1-37); Enteroglucagon
Molecular Formula:C192H295N59O60S
Molecular Weight:4421.86
Sequence:HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Appearance:White to off-white solid
Purity:~81% NPC
Solubility:Water: 1mg/ml
Storage and Stability:May be stored at RT for short-term only. Long-term storage is recommended at -20°C. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
