85-2075-18　PACAP-27, Amide, Sheep (Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2) 0.5mg　CAS No:127317-03-7　217620

特徴

• Increases cAMP levels in a dose-dependent manner (EC50=4.7nM). Increases tyrosine hydroxylase expression in chromaffin cells.
• Synonyms:Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
• Sequence:H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2
• Molecular Formula:C₁₄₂H₂₂₄N₄₀O₃₉S
• Molecular Weight:3147.7
• Solubility:5% acetic acid (1mg/ml)
• Primary Target:Increases cAMP levels
• Cell permeable:No
• Form:Supplied as a trifluoroacetate salt.
• Appearance:White to off-white solid
• Purity:≥98% (HPLC)
• Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.