Glucagon-like peptide 2, a cleavage product of Glucagon. Glucagon-like peptide 2 plays a key role in nutrient homeostatis and stimulates intestinal growth and glucose transport.
Source:Human Glucagon-Like Peptide 2
Sequence:HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Applications:Suitable for use in ELISA. Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 12 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size：1mg
Source Antigen：Synthetic
Grade：Purified
Purity：≥90% (HPLC)
Form：Supplied as a lyophilized powder. Reconstitute with 1ml ddH2O.
