UbcH3 also called Cdc34 is important in the control of cell cycle and DNA replication. Cdc34 in association with different E3 complexes, including SCF, has been shown to target many different substrates for ubiquitination and degradation during cell division, signal transduction, and development. Cdc34 substrates that have been characterized include IkB, B-Myb, Wee1, MyoD, ICERIIgamma, ATF5, p27Xic1, and p27Kip1. Additionally, substrates such as beta-catenin, p21Cip1, E2F, cyclin E, and cyclin D are putative substrates of Cdc34 by virtue of their SCF requirement for proteolysis. Cdc34 has been demonstrated to self-associate through a domain in the C-terminus, and is phosphorylated and ubiquitinylated in vivo. This protein is useful for in vitro ubiquitinylation reactions.
Source:Recombinant protein corresponding to 248aa from human Ubc3, fused to 6x His-tag, expressed in E. coli.
Molecular Weight:~28kD
AA Sequence:MHHHHHHAMGILMARPLVPSSQKALLLELKGLQEEPVEGFRVTL VDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFR FLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNV RTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIR KQVTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYY EDGEVEEEADSCFGDDEDDSGTEES
Storage and Stability:Lyophilized powder may be stored at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size：10ug
Source Antigen：Recombinant, E. coli
Grade：Highly Purified
Purity：~95% (RP-HPLC, SDS-PAGE)
Form：Supplied as a lyophilized powder in PBS, pH 7.5, 1mM DTT. Reconstitute with 100ug/ml sterile ddH2O.
