85-2068-14　Synuclein, gamma, Recombinant, Mouse (BCSG1, SYN) 50ug　209227

特徴

• Parkinson's disease (PD) is a common neurodegenerative disorder with a lifetime incidence of ~2 percent; the clinical manifestations of this neurodegenerative disorder include resting tremor, muscular rigidity, bradykinesia, and postural instability. A relatively specific pathological feature accompanying the neuronal degeneration is an intracytoplasmic inclusion body, known as the Lewy body. A mutation was identified in the a- synuclein gene, which codes for a presynaptic protein thought to be involved in neuronal plasticity, this mutation may cause a conformational change that renders a-synuclein more prone to self aggregation and deposition in Lewy bodies, which finally leads to oxidative stress and misfolding of -synuclein. Parkin gene, mutations in this gene are reported in early autosomal-recessive form of PD, however these mutations do not degenerate Lewy bodies. The Parkin gene product (Parkin) is involved in protein degradation as a ubiquitin protein ligase, the known substrates of Parkin include Pael-R (Parkin-associated endothelin receptor-like receptor), Ubiquitination of Pael-R by Parkin leads to its degradation in the proteasome, however failure to ubiquitinate it leads to death of neuron.
• The synuclein exists in 3 isoform a-syn (chrm 4q21), a 140aa protein, implicated in pathogenesis of PD and related neurodegenerative disorders, it is mainly expressed in brain specifically in neuronal cell bodies and synapses. The 134aa beta-syn (chrm 5q35) is homologous to 14kD bovine phosphoneuroprotein 14; SCNB has been shown to be highly expressed in the substantia nigra of the brain. Recently a new isoform termed gamma-synuclein (SNCG) or breast cancer gene 1 (BCG1) has been cloned (human 127aa (chrm 10q23), rat/mouse 123aa). Higher levels of expression of SNCG have been reported in advanced breast carcinomas. All three synuclein show ~40% identity.
• Mouse Gamma synuclein recombinant protein, an acidic neuronal protein of 127aa. It is up regulated in the majority of late-stage breast and ovarian cancers, it promotes cancer cell survival and inhibits stress and chemotherapy drug induced apoptosis by modulating MAP kinase pathways.
• Source:Recombinant protein corresponding to 127aa from mouse gamma-Synuclein, expressed in E. coli.
• Molecular Weight:Migrates as ~16kD band in SDS-PAGE (reduced)
• AA Sequence:MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKEN VVQSVTSVAEKTKEQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVV RKEDLEPPAQDQEAKEQEENEEAKS GED
• Applications:Suitable for use in ELISA standards or Western Blot. Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Storage and Stability:Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.