GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.
Source:Recombinant protein corresponding to aa401-500 from human GABRA4 partial ORF, fused to GST tag at N-terminal, expressed in wheat germ (in vitro).
Molecular Weight:~36.63kD
AA Sequence:GNRTEVGNHSSKSSTVVQESSKGTPRSYLASSPNPFSRANAAETISAARALPSASPTSIRTGYMPRKASVGSASTRHVFGSRLQRIKTTVNTIGATGKLS
Applications:Suitable for use in ELISA, Western Blot, Antibody Production and Protein Array. Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：10ug
Source Antigen：Recombinant, wheat germ
Grade：Purified
Purity：Glutathione Sepharose 4 Fast Flow.
Form：Supplied as a liquid in elution buffer, 50mM Tris-HCI, 10mM reduced glutathione, pH 8.0.
