85-2056-97　CD28, Fc Fusion, Recombinant, Human (T-Cell-Specific Surface Glycoprotein, TP44) 200ug　172324

特徴

• Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival.
• Product Description:Human secreted CD28-Fc fusion protein (GenBank Accession No. NM_006139), aa 19-152, expressed in a HEK293 cell expression system.
• Molecular Weight:~41.4kD (monomer). This protein runs at a higher molecular weight due to glycosylation.
• Amino Acid Sequence:NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPDMDPKSCDKTHTCPPCP APELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS VMHEALHNHYTQKSLSLSPGK
• Note:NKIL..... PSKP: CD28 (aa 19-152)DMD: Linker amino acidsPKSC....SPGK: Fc of human IgG1 (aa 100-330)
• Applications:Suitable for use in studies of protein-protein interaction and in in vitro and in vivo protein function studies. Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Storage and Stability:Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.