S1 region attaches the virion to the cell membrane by interacting with cell receptors, initiating the infection. Binding to the receptor probably induces conformational changes in the S glycoprotein unmasking the fusion peptide of S2 region and activating membranes fusion.
Source:Recombinant protein corresponding to aa19-278 from PEDV, fused to His-tag derived from yeast.
Molecular Weight:~30kD
AA Sequence:LPQDVTRCQSTTNFRRFFSKFNVQAPAVVVLGGYLPSMNSSSWYCGTGIETASGVHGIFLSYIDSGQGFEIGISQEPFDPSGYQLYLHKATNGNTNAIARLRICQFPDNKTLGPTVNDVTTGRNCLFNKAIPAYMRDGKDIVVGITWDNDRVTVFADKIYHFYLKNDWSRVATRCYNRRSCAMQYVYTPTYYMLNVTSAGEDGIYYEPCTANCTGYAANVFATDSNGHIPEGFSFNNWFLLSNDSTLLHGKVVSNQPLLV
Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size：500ug
Source Antigen：Recombinant
Grade：Purified
Purity：≥90% (SDS-PAGE)
Form：Supplied as a liquid in Tris buffer, pH 8.0, 50% glycerol.
