Component of the viral envelope that plays a central role in virus morphogenesis and assembly. It is sufficient to form virus-like particles. Seems to be important for creating the membrane curvature needed to acquire the rounded, stable and infectious particle phenotype. Acts as a viroporin, inducing the formation of hydrophilic pores in cellular membranes. Also induces apoptosis
Source:Full length recombinant protein corresponding to aa1-76 from PEDV, fused to His-tag derived from yeast.
Molecular Weight:~10kD
AA Sequence:MLQLVNDNGLVVNVILWLFVLFFLLIISITFVQLVNLCFTCHRLCNSAVYTPIGRLYRVYKSYMRIDPLPSTVIDV
Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size：500ug
Source Antigen：Recombinant
Grade：Purified
Purity：≥90% (SDS-PAGE)
Form：Supplied as a liquid in Tris buffer, pH 8.0, 50% glycerol.
