The replicase polyprotein of coronaviruses is a multifunctional protein: it contains the activities necessary for the transcription of negative stranded RNA, leader RNA, subgenomic mRNAs and progeny virion RNA as well as proteinases responsible for the cleavage of the polyprotein into functional products.
Source:Recombinant protein corresponding to aa4707-4869 from PEDV, fused to His-tag derived from yeast.
Molecular Weight:~19kD
AA Sequence: PCLMGWDYPKCDRALPNMIRMISAMILGSKHTTCCSSTDRFFRLCNELAQVLTEVVYSNGGFYLKPGGTTSGDATTAYANSVFNIFQAVSANVNKLLSVDSNVCHNLEVKQLQRKLYECCYRSTIVDDQFVVEYYGYLRKHFSMMILSDDGVVCYNNDYASLG
Storage and Stability:May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
仕様
Size：500ug
Source Antigen：Recombinant
Grade：Purified
Purity：≥90% (SDS-PAGE)
Form：Supplied as a liquid in Tris buffer, pH 8.0, 50% glycerol.
