85-1788-59　CTGFL/WISP-2, Recombinant, Human (Connective Tissue Growth Factor-Like protein, CCN5, CT-58) 5ug　143304

特徴

• CTGFL/WISP-2 is a 28.6kD protein that belongs to the CCN family of cysteine rich regulatory proteins.Members of this family stimulate mitosis, adhesion, apoptosis, extracellular matrix production, growth arrest, and migration of multiple cell types.The protein is expressed in primary osteoblasts, fibroblasts, ovary, testes, and heart.In addition to promoting adhesion of osteoblasts, CTGFL/WISP-2 inhibits osteocalcin production, as well as binding of fibrinogen to integrin receptors. Recombinant human CTGFL/WISP-2 is a 24.3kD protein of 228 amino acid residues.
• Biological Activity:The ED50 was determined by its ability to inhibit IGF-II induced proliferation of MCF-7. The expectd ED50 is between 10-20ng/ml in the presence of 15ng/ml of human IGF-II.
• Amino Acid Sequence:MQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
• Protein Content:Verified by UV Spectroscopy and/or SDS-PAGE gel.
• Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.