85-1572-25　PRMT2, Recombinant, Human (Protein arginine N-Methyltransferase 2, Histone-arginine N-methyltransferase PRMT2, HMT1, HRMT1L1) 10ug　P9004-12

特徴

• PRMT2 ( NP_001526.2, aa1-433) full-length recombinant protein with GST tag.
• Arginine methylation is an irreversible post translational modification which has only recently been linked to protein activity. At least three types of PRMT enzymes have been identified in mammalian cells. These enzymes have been shown to have essential regulatory functions by methylation of key proteins in several fundamental areas. These protein include nuclear proteins, IL enhancer binding factor, nuclear factors, cell cycle proteins, signal transduction proteins, apoptosis proteins, and viral proteins. The mammalian PRMT family currently consists of 7 members that share two large domains of homology. Outside of these domains, epitopes were identified and antibodies against all 7 PRMT members have been developed.
• Amino Acid Sequence:MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSAD
• Molecular Weight (Theoretical): 76kD
• Applications:Suitable for use in ELISA and Western Blot. Other applications have not been tested.
• Recommended Dilution:Optimal dilution to be determined by the researcher.
• Storage and Stability:Store at -70°C. Stable for at least 3 months at -70°C. Avoid freeze-thaw cycles. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.