Source:Synthetic peptide corresponding to YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQYNH2 of human neuropeptide Y.
Molecular Weight:4271.8amu
Applications:Suitable for use in ELISA. Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only. For long-term storage, aliquot and store at -20°C. Aliquots are stable for at least 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.