85-1453-55　［取扱停止］Ubc12, Recombinant, Human (Ubiquitin Conjugating Enzyme 12) 10ug　U0880-30

特徴

• Recombinant Human UbcH12 is functional in in vitro NEDDylation reactions. It has been shown to form a thioester linkage with NEDD8 in the presence of the NEDD8 activating enzyme complex Uba3/APP-BP1. APP-BP1 binds to the amyloid precursor protein (APP) carboxy terminal domain and is important in conjunction with Uba3 and UbcH12 in driving cells through the S to M checkpoint. It was demonstrated to be the E2 responsible for the NEDDylation of the Cul-1 component of the SCF( -TRCP) complex which is important as the E3-ligase in the ubiquitinylation of I B . NEDDylation of Cul-1 is essential for conjugation and processing of NF- B p105 by SCF( -TRCP) following phosphorylation of the complex. A dominant negative form of UbcH12, previously demonstrated to sequester NEDD8 and inhibit its conjugation, inhibits both conjugation and processing of p105, which is alleviated by wild-type UbcH12. Recombinant Human Ubiquitin Conjugating Enzyme 12 produced in E.coli is a 25kD protein containing 216 amino acids.
• Amino Acid Sequence:MSYYHHHHHHDYDIPTTENLYFQGAMDPEFRIWMIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINE LNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNIL REDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK.
• Endotoxin:≤ 0.1ng/ug (IEU/ug) of rHuUbc12.
• Solubility:It is recommended to reconstitute the lyophilized rHuUbc12 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Stability:Lyophilized rHuUbc12 although stable at room temperature for 3 weeks, should be stored desiccated below -180C. Upon reconstitution rhUbc12 should be stored at 40C between 2-7 days and for future use below -180C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.