85-1453-49　［取扱停止］UbcH1, Recombinant, Human (Huntingtin Interacting Protein 2, HIP2) 10ug　U0850-15

特徴

• Among ubiquitin-conjugating enzymes, the mammalian ubiquitin conjugating enzyme UbcH1, also known as HIP2, is unique in its ability to catalyze the in vitro synthesis of unanchored Lys48-linked poly-ubiquitin chains from mono- or poly-ubiquitin, E1, and ATP. In addition, UbcH1 can catalyse the cyclization of longer poly-ubiquitin chains, including tetra- and penta-ubiquitin. Recombinant UbcH1 charges and supports ubiquitinylation in vitro. Typical enzyme concentration to support conjugation in vitro is 100nM to 1 M. Recently, HIP2 (or UbcH1) has been shown to bind to the N terminus of huntington and may play a role in Huntington disease. Recombinant Human UbcH1 also called HIP-2 produced in E.Coli is a non-glycosylated, Polypeptide chain containing 208 amino acids and having a molecular mass of 23.4kD. The human UbcH1 protein contains 6xHis tag and is purified by proprietary chromatographic techniques.
• Amino Acid Sequence:MHHHHHHAMANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPP DTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQ WAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHV YAGAPVSSPEYTKKIENLCAMGFDAVIVALSSKSWDVETATELLLSN.
• Endotoxin:≤ 0.1ng/ug (IEU/ug) of recombinant human UbcH1.
• Solubility:It is recommended to reconstitute the lyophilized recombinant human HIP-2 in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
• Stability:Lyophilized recombinant HIP-2 although stable at room temperature for 3 weeks, should be stored desiccated below -180C. Upon reconstitution recombinant human UbcH1 should be stored at 40C between 2-7 days and for future use below -180C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please avoid freeze-thaw cycles.