85-1453-32　［取扱停止］Transforming Growth Factor beta 1, Recombinant, Human (TGFb1) 10ug　T8250-13F

特徴

• Transforming growth factor-betas (TGF betas) are multifunctional peptides that regulate growth and differentiation in a variety of cells. The transforming growth factor beta (TGF-beta) family of growth modulators play critical roles in tissue development and maintenance. Recent data suggest that individual TGF-beta isoforms (TGF-beta 1, -beta 2 and -beta 3) have overlapping yet distinct biological actions and target cell specificities, both in developing and adult tissues.
• Transforming growth factor beta mediates many cell-cell interactions that occur during embryonic development. Three TGF betas have been identified in mammals. TGF beta-1, TGF beta-2 and TGF beta-3 are each synthesized as precursor proteins that are very similar in that each is cleaved to yield a 112 amino acid polypeptide that remains associated with the latent portion of the molecule. This antibody reacts with the precursor and mature form of recombinant human TGF beta- 2 and to a lesser extent TGF beta-3, but does not cross react with TGF beta-1.
• Description:Recombinant protein corresponding to aa309-390 from human TGF-b1 purified by standard chromatographic techniques. Shows a 35kD band on SDS-PAGE (including GST tag).
• Amino Acid Sequence:KWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
• Storage and Stability:For long-term storage, aliquot and store at -20°C. Aliquots are stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: It is recommended to add a carrrier protein (0.1% HSA or BSA) for long-term storage.