85-1452-19　［取扱停止］Phospholipase A2, Secretory, Group XII, Recombinant, Human (PLA2, sPLA2-XII) 2ug　P4074-06R

特徴

• Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators. The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of lowmolecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense. This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso- PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci. In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.
• Description:Recombinant Human Secreted Phospholipase A2-XII was produced with N-terminal His-Tag, is 20.6kD polypeptide containing 167 amino acid residues of the human secreted phospholipase A2-XII and 16 additional amino acid residues.
• Amino Acid Sequence: MRGSHHHHHHGMASHMQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPR YGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHV QACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL
• Specificity:The amino acid sequence of the recombinant human Secreted Phospholipase A2-XII is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-XII without signal sequence.
• Applications:Western blotting
• Reconstitution:Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely.
• Storage:Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.