85-1451-76　［取扱停止］Neuregulin 1, Recombinant, Human (NRG1, NDF) 10ug　N2108-75

特徴

• Neuregulin is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells, playing an important role in heart structure and function through inducing ErbB2/ErbB4 receptor phosphorylation and cardiomyocyte differentiation. Research on molecular level discovered that recombinant neuregulin could make disturbed myocardial cell structure into order and strengthen the connection between myocardial cells by intercalated discs re-organization. Pharmacodynamic experiments in animals showed that recombinant neuregulin (NRG1) can reduce the degree of damage on myocardial cells caused by ischemia, hypoxia and viral infection.
• Recombinant Human Neuroregulin-1 (Neu differentiation factor) produced in E. coli is a single, non-glycosylated polypeptide chain containing 61 amino acids having a molecular mass of 7055D. Recombinant Human NRG1 is purified by proprietary chromatographic techniques.
• Amino Acid Sequence: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ
• Biological Activity:The activity measured by its ability to stimulate the proliferation of human MCF-7 cells grown under serum-free conditions corresponding to a specific activity of 1.2×10e4 IUs/mg.
• Storage and Stability:Lyophilized powder may be stored at -20°C. Stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.