Amino Acid Sequence:[protein fragment, 39 aa] Labeled with Biotin (linear)
Molecular Formula:C222H328N56O68S4
Molecular Weight:4997.66
Purity:≥80%
Form:Supplied as a lyophilized powder
Storage and Stability:Lyophilized powder may be stored at 4°C for short-term only. Stable for 6 months after receipt at -20°C. Reconstitute (see reconstitution instructions for peptides) and store at -20°C. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
