Applications:Suitable for use in Western Blot, Immunohistochemistry, Immunocytochemistry and Immunoprecipitation.
Other applications not tested.
Recommended Dilution:Western Blot: 0.2-2ug/mlImmunohistochemistry: 5-20ug/mlImmunocytochemistry: 5-20ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:200ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A and peptide affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.4, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human Gastrin Releasing Peptide.
Isotype:IgG
Calc Applications Abbrev:IC IHC IP WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide corresponding human Gastrin Releasing Peptide, conjugated to OVA.