Zinc finger proteins, such as ZNF272, interact with nucleic acids and have diverse functions.
The zinc finger domain is a conserved AA sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc.
Kruppel-related proteins form 1 family of zinc finger proteins.
See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM, May 2004]
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
AA Sequence:SEMQEYFLRPGTDPQSEKLHGKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGENSYKFEEMFNENCFLVQHEQILPRVKPYDCPECGKAFGKSKH
Positive Control:BxPC-3, rat liver, rat pancreas
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：200ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity：Recognizes human ZNF460. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Rt
Immunogen：Recombinant fusion protein containing a sequence corresponding to aa100-210 of human ZNF460 (NP_006626.3).
