84-5392-79　［取扱停止］WASF3 200ul　532079

特徴

• This gene encodes a member of the Wiskott-Aldrich syndrome protein family.
• The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin.
• Binding to actin occurs through a C-terminal verprolin homology domain in all family members.
• The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.
• A pseudogene of this gene have been defined on chromosome 6.
• Alternative splicing results in multiple transcript variants.
• Applications:Suitable for use in Western Blot and Immunohistochemistry.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:500-1:2000Immunohistochemistry: 1:100-1:200Optimal dilutions to be determined by the researcher.
• AA Sequence:RTRKEEWERRKMGIEFMSDAKKLEQAGSAKEDRVPSGSHASDVTDYSYPATPNHSLHPQPVTPSYAAGDVPPHGPASQAAEHEYRPPSASARHMALNRPQQ
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.