Vasodilator-stimulated phosphoprotein (VASP) is a member of the Ena-VASP protein family.
Ena-VASP family members contain an EHV1 N-terminal domain that binds proteins containing E/DFPPPPXD/E motifs and targets Ena-VASP proteins to focal adhesions.
In the mid-region of the protein, family members have a proline-rich domain that binds SH3 and WW domain-containing proteins.
Their C-terminal EVH2 domain mediates tetramerization and binds both G and F actin.
VASP is associated with filamentous actin formation and likely plays a widespread role in cell adhesion and motility.
VASP may also be involved in the intracellular signaling pathways that regulate integrin-extracellular matrix interactions.
VASP is regulated by the cyclic nucleotide-dependent kinases PKA and PKG.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:2000Optimal dilutions to be determined by the researcher.
AA Sequence:MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAA
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human VASP. Species Crossreactivity: mouse
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo
Immunogen:Synthetic peptide corresponding to a sequence within aa1-100 of human VASP (NP_003361.1).