84-5388-87　［取扱停止］TNNT3 100ul　531950

特徴

• The binding of Ca(2+) to the trimeric troponin complex initiates the process of muscle contraction.
• Increased Ca(2+) concentrations produce a conformational change in the troponin complex that is transmitted to tropomyosin dimers situated along actin filaments.
• The altered conformation permits increased interaction between a myosin head and an actin filament which, ultimately, produces a muscle contraction.
• The troponin complex has protein subunits C, I, and T.
• Subunit C binds Ca(2+) and subunit I binds to actin and inhibits actin-myosin interaction.
• Subunit T binds the troponin complex to the tropomyosin complex and is also required for Ca(2+)-mediated activation of actomyosin ATPase activity.
• There are 3 different troponin T genes that encode tissue-specific isoforms of subunit T for fast skeletal-, slow skeletal-, and cardiac-muscle.
• This gene encodes fast skeletal troponin T protein; also known as troponin T type 3.
• Alternative splicing results in multiple transcript variants encoding additional distinct troponin T type 3 isoforms.
• A developmentally regulated switch between fetal/neonatal and adult troponin T type 3 isoforms occurs.
• Additional splice variants have been described but their biological validity has not been established.
• Mutations in this gene may cause distal arthrogryposis multiplex congenita type 2B (DA2B).
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Western Blot: 1:200-1:2000Optimal dilutions to be determined by the researcher.
• AA Sequence:SMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.