The binding of Ca(2+) to the trimeric troponin complex initiates the process of muscle contraction.
Increased Ca(2+) concentrations produce a conformational change in the troponin complex that is transmitted to tropomyosin dimers situated along actin filaments.
The altered conformation permits increased interaction between a myosin head and an actin filament which, ultimately, produces a muscle contraction.
The troponin complex has protein subunits C, I, and T.
Subunit C binds Ca(2+) and subunit I binds to actin and inhibits actin-myosin interaction.
Subunit T binds the troponin complex to the tropomyosin complex and is also required for Ca(2+)-mediated activation of actomyosin ATPase activity.
There are 3 different troponin T genes that encode tissue-specific isoforms of subunit T for fast skeletal-, slow skeletal-, and cardiac-muscle.
This gene encodes fast skeletal troponin T protein; also known as troponin T type 3.
Alternative splicing results in multiple transcript variants encoding additional distinct troponin T type 3 isoforms.
A developmentally regulated switch between fetal/neonatal and adult troponin T type 3 isoforms occurs.
Additional splice variants have been described but their biological validity has not been established.
Mutations in this gene may cause distal arthrogryposis multiplex congenita type 2B (DA2B).
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1:200-1:2000Optimal dilutions to be determined by the researcher.
AA Sequence:SMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human TNNT3. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Recombinant fusion protein containing a sequence corresponding to aa147-256 of human TNNT3 (NP_001036246.1).