This gene encodes a subunit of a large protein complex known as a vacuolar H+-ATPase (V-ATPase).
The protein complex acts as a pump to move protons across the membrane.
This movement of protons helps regulate the pH of cells and their surrounding environment.
V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis.
V-ATPase is comprised of a cytosolic V1 domain and a transmembrane V0 domain.
Alternative splicing results in multiple transcript variants.
Mutations in this gene are associated with infantile malignant osteopetrosis.
Applications:Suitable for use in Western Blot and Immunofluorescence.
Other applications not tested.
Recommended Dilution:Western Blot: 1:200-1:2000Immunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
AA Sequence:MGSMFRSEEVALVQLFLPTAAAYTCVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEELEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRAQLHQLQLHAA
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Specificity:Recognizes human TCIRG1. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Recombinant fusion protein containing a sequence corresponding to aa1-130 of human TCIRG1 (NP_006010.2).