The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome.
Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins.
The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors.
In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation.
Two transcript variants encoding different isoforms have been found for this gene.
Applications:Suitable for use in Western Blot and Immunofluorescence.
Other applications not tested.
Recommended Dilution:Western Blot: 1:500-1:1000Immunofluorescence: 1:50-1:200Optimal dilutions to be determined by the researcher.
AA Sequence:AEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH