84-5384-16　［取扱停止］SOX10 200ul　531794

特徴

• This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate.
• The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins.
• This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development.
• Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
• Applications:Suitable for use in Western Blot, Immunohistochemistry, Immunofluorescence and Immunocytochemistry.
• Other applications not tested.
• Recommended Dilutions:Western Blot: 1:500-1:2000Immunohistochemistry (Paraffin): 1;50-1:200Immunofluorescence (IC): 1:50-1:200Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:TAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKADPKRDGRSMGEGGKPHIDFGNVDIGEISHEVMSNMETFDVAELDQY
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.